Web stats for Jayenterprise - jayenterprise.co
2.20 Rating by ClearWebStats
jayenterprise.co is 2 decades 3 years 11 months old. This website has a #11,389,778 rank in global traffic. It has a .co as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, jayenterprise.co is SAFE to browse.
Traffic Report of Jayenterprise
Daily Unique Visitors: | 42 |
Daily Pageviews: | 84 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 11,389,778 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
63
Siteadvisor Rating
Not Applicable
Where is jayenterprise.co server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 12 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | 2 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 27 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 01 Jun 2019 11:47:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Link: <http://jayenterprise.co/wp-json/>; rel="https://api.w.org/", <http://jayenterprise.co/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Sat, 01 Jun 2019 11:47:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Link: <http://jayenterprise.co/wp-json/>; rel="https://api.w.org/", <http://jayenterprise.co/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information for jayenterprise.co
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
jayenterprise.co | A | 10792 |
IP:162.241.148.33 |
jayenterprise.co | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
jayenterprise.co | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
jayenterprise.co | SOA | 10800 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:cpanel.webhostbox.net Serial:2019052802 Refresh:3600 Retry:1800 Expire:1209600 |
jayenterprise.co | MX | 14400 |
Target:jayenterprise.co |
jayenterprise.co | TXT | 14400 |
TXT:v=spf1 +a +mx +ip4:162.241.148.33 ~all |
Similarly Ranked Websites to Jayenterprise
Bolsos originales hecho en España con estampados originales
- sanyurishop.com
Bolsos de diseño exclusivo fabricados con piel y lona de algodón. Hecho en España. De inspiración Mediterránea. Diseñado y producido por Sanyuri.
Full WHOIS Lookup for jayenterprise.co
Domain Name: jayenterprise.co
Registry Domain ID: D85F431BF3BA64E98BF7CDC150C2AB098-NSR
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-05-29T07:57:17Z
Creation Date: 2019-05-23T08:51:38Z
Registry Expiry Date: 2020-05-23T08:51:38Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: WhoisGuard, Inc.
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns1.bh-ht-17.webhostbox.net
Name Server: ns2.bh-ht-17.webhostbox.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-06-01T11:46:54Z
Registry Domain ID: D85F431BF3BA64E98BF7CDC150C2AB098-NSR
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-05-29T07:57:17Z
Creation Date: 2019-05-23T08:51:38Z
Registry Expiry Date: 2020-05-23T08:51:38Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: WhoisGuard, Inc.
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns1.bh-ht-17.webhostbox.net
Name Server: ns2.bh-ht-17.webhostbox.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-06-01T11:46:54Z